PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017196m
Common NameEUTSA_v10017196mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 232aa    MW: 25523.2 Da    PI: 10.5697
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017196mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind263.41.3e-803423199301
        GAGA_bind  99 vqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekk 192
                      +  ++ t+ id +q    +q ++s v +  +  l  +p+++++++++++k+k+++ ++++++++k +kkk++ +k+ kk++++   +++k+ekk
  Thhalv10017196m  34 YFPVPRTTGIDLSQL---SQENPSEVVMVPQARLFPPPTRDSRSDMETVKHKSSKLSPSEALKPKPQKKKRSASKNPKKTAPSV--PETKREKK 122
                      445677777777776...555666666899999***********************************9996666555555444..79****** PP

        GAGA_bind 193 sidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLk 286
                      + d++++  s+D s++P+PvCsCtG++r+CYkWG+GGWqS+CCt++iS+yPLP+st+r+g R+agrKmS+ga+ klL +La+eGydl  pvDL+
  Thhalv10017196m 123 NPDINIDISSFDVSGVPPPVCSCTGVPRVCYKWGMGGWQSSCCTISISTYPLPMSTTRPGVRLAGRKMSNGAYVKLLMRLAGEGYDLTLPVDLR 216
                      ********************************************************************************************** PP

        GAGA_bind 287 dhWAkHGtnkfvtir 301
                      +hWA+HGtnkfvti+
  Thhalv10017196m 217 NHWARHGTNKFVTIK 231
                      **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-961231IPR010409GAGA-binding transcriptional activator
PfamPF062172.8E-6873231IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MNNSYPSRNH IQSATSASKD TGLPTSNAHW FHSYFPVPRT TGIDLSQLSQ ENPSEVVMVP  60
QARLFPPPTR DSRSDMETVK HKSSKLSPSE ALKPKPQKKK RSASKNPKKT APSVPETKRE  120
KKNPDINIDI SSFDVSGVPP PVCSCTGVPR VCYKWGMGGW QSSCCTISIS TYPLPMSTTR  180
PGVRLAGRKM SNGAYVKLLM RLAGEGYDLT LPVDLRNHWA RHGTNKFVTI K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410714.11e-172hypothetical protein EUTSA_v10017196mg
SwissprotO822861e-130BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLV4MAM51e-172V4MAM5_EUTSA; Uncharacterized protein
STRINGBra023013.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136742127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.41e-126basic pentacysteine 7